USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Sea Moss Facial Cleanser
Sea Moss Facial Cleanser Sea Moss Facial Cleanser

Sea Moss Facial Cleanser

$19.90 inc. tax
About Sea Moss Facial Cleanser
Ingredients: Purified Water, Potassium Hydroxide, Glycerine, Coconut Oil, Olive Oil, Sea Moss, Aloe Vera, Jojoba Oil, Oleic Acid, Fragrance, Black Seed Oil
Product Code: tW1k9ZL
weight: 0.5 lb
Product Condition: New
Related Products
Shea Olein: Organic Tha..
Shea Olein: Organic Tha..
$3.89
Mango Butter African soap
Mango Butter African soap
$3.90
Dudu-Osun African Black..
Dudu-Osun African Black..
$3.98
Neem oil {Organic} 8oz
Neem oil {Organic} 8oz
$9.99
Pure Black Seed Oil
Pure Black Seed Oil
$17.95
Jojoba Oil 4oz
Jojoba Oil 4oz
$29.99
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Register to earn Loyalty Points points
Loyalty Program
Join our VIP rewards program today!
Register to earn Loyalty Points
Points mean prizes!
Ways to earn
Welcome gift
see more..
Ways to redeem
% discount!
Free Shipping
see more..
Join today
Already have an account?Sign in