USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Faux Fur Knited Leg Warmer

Faux Fur Knited Leg Warmer

$1.99 inc. tax
A warm, Nordic-inspired emblem that communicates coziness, craft, and warmth—perfect for a knitted faux fur product.
Product Code: K23aBhg
weight: 4.0 oz
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Vintage Design Leg Warm..
Vintage Design Leg Warm..
$1.99
Cotton Over Knee Socks ..
Cotton Over Knee Socks ..
$1.99
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Register to earnLoyalty Points
Loyalty Program
Join our VIP rewards program today!
Register to earn Loyalty Points
Points mean prizes!
Ways to earn
Welcome gift
see more..
Ways to redeem
% discount!
Free Shipping
see more..
Join today
Already have an account?Sign in